addressalign-toparrow-leftarrow-rightbackbellblockcalendarcameraccwcheckchevron-downchevron-leftchevron-rightchevron-small-downchevron-small-leftchevron-small-rightchevron-small-upchevron-upcircle-with-checkcircle-with-crosscircle-with-pluscrossdots-three-verticaleditemptyheartexporteye-with-lineeyefacebookfolderfullheartglobegmailgooglegroupshelp-with-circleimageimagesinstagramFill 1linklocation-pinm-swarmSearchmailmessagesminusmoremuplabelShape 3 + Rectangle 1ShapeoutlookpersonJoin Group on CardStartprice-ribbonShapeShapeShapeShapeImported LayersImported LayersImported Layersshieldstartickettrashtriangle-downtriangle-uptwitteruserwarningyahoo

BioCurious Message Board › IL-2 sequence from last week's meetup

IL-2 sequence from last week's meetup

Eri G.
supersalad
Group Organizer
Palo Alto, CA
Text version. I have the actual Gene Designer file (you'll need the program to open it) but I can't send through meetup.com; so, if you want the file, email me and I'll send it

Gene:

GAATTCATGGCTCCTACTTCTTCTTCTACTAAGAAAAC­TCAACTGCAACTGGAACACCTGCTGCTGGACCTGCAGATG­ATTCTGAATGGTATTAACAACTACAAAAACCCGAAACTGA­CCCGTATGCTGACCTTCAAATTCTATATGCCGAAGAAGGC­TACTGAACTGAAGCACCTGCAGTGCCTGGAAGAGGAGCTG­AAACCGCTGGAGGAAGTCCTGAACCTGGCTCAGTCCAAAA­ATTTCCATCTGCGTCCGCGCGATCTGATCTCCAACATCAA­TGTTATCGTACTGGAACTGAAAGGCTCTGAGACCATTTTC­ATGTGTGAATACGCGGACGAAACGGCTACGATTGTCGAAT­TTCTGAACCGTTGGATTACCTTCTGTCAGTCCATCATTAG­CACCCTGACTGAGAACCTGTACTTCCAGGGTCACCACCAT­CACCACCACTAAGGATCC

Protein:

MAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLT­RMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKN­FHLRPRDLISNINVIVLELKGSETIFMCEYADETATIVEF­LNRWITFCQSIISTLTENLYFQGHHHHHH
Powered by mvnForum

Our Sponsors

People in this
Meetup are also in:

Sign up

Meetup members, Log in

By clicking "Sign up" or "Sign up using Facebook", you confirm that you accept our Terms of Service & Privacy Policy